DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG30289

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:252 Identity:70/252 - (27%)
Similarity:103/252 - (40%) Gaps:46/252 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGITPVDASTLAVRLG---- 89
            |.||......|.||...|..:|.  |.|::|:...:||||||||        ...|.||||    
  Fly    42 IFGGAKTNIQENPWMVLVWSSKP--CGGSLIARQFVLTAAHCVS--------FEDLYVRLGDYET 96

  Fly    90 ------TINQYAGGSIVNVKSV---IIHPSYGNFL--HDIAILELDETLVFSDRIQDIALPPTTD 143
                  .:|.:......|: ||   |:|.:|....  :|||:|.:.|.:.:||.::.|.|  ...
  Fly    97 LDPMPYCLNNHCIPKFYNI-SVDMKIVHENYNGITLQNDIALLRMSEAVEYSDYVRPICL--LVG 158

  Fly   144 EETEDVDAELPNGTPVY-VAGWGELSDGTASYKQQKANYNTLSRSLCEWEAG-YGYESVVCLSRA 206
            |:.:.:        |:: |.||||...|..|.....|....:..|.|..:.. ....|.:| :.:
  Fly   159 EQMQSI--------PMFTVTGWGETEYGQFSRILLNATLYNMDISYCNIKFNKQADRSQIC-AGS 214

  Fly   207 EGEGICRGDAGAAVIDDDKVLRGLTSFNFG-------PCGSKYPDVATRVSYYLTWI 256
            .....|:||:|..:.........|.||.:|       .|.:....|.|.|||:..||
  Fly   215 HTSNTCKGDSGGPLSSKFHYGNRLLSFQYGLVSYGSERCAANVAGVYTNVSYHREWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 68/250 (27%)
Tryp_SPc 29..259 CDD:238113 70/252 (28%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 68/250 (27%)
Tryp_SPc 42..271 CDD:238113 68/250 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.