DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG30288

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:264 Identity:65/264 - (24%)
Similarity:103/264 - (39%) Gaps:66/264 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGITPVDASTLAVRLG- 89
            :.||.||.|......||...|..:...||.|::|:...:|||.||:|.:        .:.|||| 
  Fly    40 RARIDGGRDAGMESNPWMVRVMISGKAVCGGSLITARFVLTAEHCISPM--------YMNVRLGE 96

  Fly    90 ---------------TINQYAGGSIVNVKSVIIHPSYGNFLHDIAILELDETLVFSDRIQDIALP 139
                           |...|.    |:|...|:|.:.|   :||.:|.:..:::||:.::.|.| 
  Fly    97 YDTRHPIFDCDDFVCTPRAYN----VDVDRKIVHSNPG---YDIGLLRMQRSVIFSNYVRPICL- 153

  Fly   140 PTTDEETEDVDAELPNGTPVYV-----AGWGELSDGTASYKQQKANYNTLSRSLCEWEAGYGYE- 198
                     :..:...|.|:.:     .|||..|||....:.|.|....|.:..|| ..|...: 
  Fly   154 ---------ILGKTLGGNPLSILRFNFTGWGTNSDGEEQDRLQTATLQQLPQWSCE-RPGRPLDI 208

  Fly   199 SVVCLSRAEGEGICRGDAGAAVIDDDKVLRGLTS----FNFGP-------CGSKYPDVATRVSYY 252
            |.:|......:. |:||:|..:    ..:|....    |.||.       |...  .:.|.|:::
  Fly   209 SYICAGSYISDS-CKGDSGGPL----SAIRTFEGQGRVFQFGVASQGLRLCSGL--GIYTNVTHF 266

  Fly   253 LTWI 256
            ..||
  Fly   267 TDWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 63/260 (24%)
Tryp_SPc 29..259 CDD:238113 64/261 (25%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 63/260 (24%)
Tryp_SPc 45..270 CDD:238113 61/257 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.