DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Klk7

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_036002.1 Gene:Klk7 / 23993 MGIID:1346336 Length:249 Species:Mus musculus


Alignment Length:259 Identity:74/259 - (28%)
Similarity:120/259 - (46%) Gaps:35/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LGLLIFGLILSAEASPQG-RILGGEDVAQGEYPWS-ASVRYNKAHVCSGAIISTNHILTAAHCVS 72
            |.|:...|.|:.|.:.|| ||:.|....:|.:||. |.::.|:.| |.|.::....:||||||  
Mouse     6 LSLITVLLSLALETAGQGERIIDGYKCKEGSHPWQVALLKGNQLH-CGGVLVDKYWVLTAAHC-- 67

  Fly    73 SVGITPVDASTLAVRLGT--INQYAGGSIVNVKSVIIHPSYGNFLH--DIAILELDETLVFSDRI 133
                   ......|:||:  |...:...|...|| ..||.|....|  ||.::.|||.:..|.::
Mouse    68 -------KMGQYQVQLGSDKIGDQSAQKIKATKS-FRHPGYSTKTHVNDIMLVRLDEPVKMSSKV 124

  Fly   134 QDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQQK--ANYNTLSRSLCE--WEAG 194
            :.:.||    |..|      |.||...|:|||..:....::....  ::...:|...|:  ::..
Mouse   125 EAVQLP----EHCE------PPGTSCTVSGWGTTTSPDVTFPSDLMCSDVKLISSRECKKVYKDL 179

  Fly   195 YGYESVVCLSRAEGE-GICRGDAGAAVIDDDKVLRGLTSFNFGPCGS-KYPDVATRVSYYLTWI 256
            .| ::::|....:.: ..|.||:|..::.:| .|:||.|:...|||. ..|.|.|:|..|..|:
Mouse   180 LG-KTMLCAGIPDSKTNTCNGDSGGPLVCND-TLQGLVSWGTYPCGQPNDPGVYTQVCKYKRWV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 66/238 (28%)
Tryp_SPc 29..259 CDD:238113 66/239 (28%)
Klk7NP_036002.1 Tryp_SPc 25..241 CDD:214473 66/238 (28%)
Serine protease. /evidence=ECO:0000250 26..246 66/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837559
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.