DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and TPSD1

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:245 Identity:67/245 - (27%)
Similarity:111/245 - (45%) Gaps:50/245 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LGLLIFGLILSA----------EASPQGRILGGEDVAQGEYPWSASVRYNK---AHVCSGAIIST 61
            |.||:..|.:.|          :|..|..|:||::..:.::||..|:|...   .|.|.|::|..
Human     9 LSLLLLALPVLASPAYVAPAPGQALQQTGIVGGQEAPRSKWPWQVSLRVRGPYWMHFCGGSLIHP 73

  Fly    62 NHILTAAHCVSSVGITP--VDASTLAVRLGTINQYAGGSIVNVKSVIIHPSY-----GNFLHDIA 119
            ..:|||||||.     |  .|.:.|.|:|...:.|....::.|..:|:||.:     |   .|||
Human    74 QWVLTAAHCVE-----PDIKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTG---ADIA 130

  Fly   120 ILELDETLVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGT---ASYKQQKANY 181
            :|||:|.:..|..|..:.|||.::        ..|.|.|.:|.|||::.:..   ..|..::...
Human   131 LLELEEPVNISSHIHTVTLPPASE--------TFPPGMPCWVTGWGDVDNNVHLPPPYPLKEVEV 187

  Fly   182 NTLSRSLCEWE------AGYGYESV----VCLSRAEGEGICRGDAGAAVI 221
            ..:...||..|      .|:.::.|    :| :.:|....|:||:|..::
Human   188 PVVENHLCNAEYHTGLHTGHSFQIVRDDMLC-AGSENHDSCQGDSGGPLV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 60/217 (28%)
Tryp_SPc 29..259 CDD:238113 60/216 (28%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 60/216 (28%)
Tryp_SPc 38..240 CDD:214473 60/216 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7244
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.