DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and PRSS54

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001073961.1 Gene:PRSS54 / 221191 HGNCID:26336 Length:395 Species:Homo sapiens


Alignment Length:293 Identity:69/293 - (23%)
Similarity:121/293 - (41%) Gaps:78/293 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GLGLLIFGLILSAEAS--PQGRILGGEDVAQG-----EYPWSASVRYNK-AHVCSGAIISTNHIL 65
            |:.|::.||:.|:.:.  .:..:..|.|..:|     |:||..|::.:: .|:..|.|:|...:|
Human    15 GVLLVLLGLLYSSTSCGVQKASVFYGPDPKEGLVSSMEFPWVVSLQDSQYTHLAFGCILSEFWVL 79

  Fly    66 TAAHCVSS-------VGITPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSYGN--FLHDIAIL 121
            :.|..:.:       |||:.:|.|.:|     ..:|.      |.::|||..:.|  ..::||:|
Human    80 SIASAIQNRKDIVVIVGISNMDPSKIA-----HTEYP------VNTIIIHEDFDNNSMSNNIALL 133

  Fly   122 ELDETLVFSDRIQDIAL-------PPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQQKA 179
            :.|..:.|.:.:|.|..       ||.           |.|   .:|:||...|        ...
Human   134 KTDTAMHFGNLVQSICFLGRMLHTPPV-----------LQN---CWVSGWNPTS--------ATG 176

  Fly   180 NYNTLS---------RSLCEWEAGYGYESVVCLS--RAEGEGICRGDAGAAVI-----DDDKVLR 228
            |:.|:|         ..:|..   |..:...|.|  :.|.:..|.||.|:.::     .|..|||
Human   177 NHMTMSVLRKIFVKDLDMCPL---YKLQKTECGSHTKEETKTACLGDPGSPMMCQLQQFDLWVLR 238

  Fly   229 GLTSFNFGPCGSKYPDVATRVSYYLTWIEANTQ 261
            |:.:|....|...:  :.|:|..|..||.:..:
Human   239 GVLNFGGETCPGLF--LYTKVEDYSKWITSKAE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 62/265 (23%)
Tryp_SPc 29..259 CDD:238113 64/267 (24%)
PRSS54NP_001073961.1 Tryp_SPc 52..264 CDD:214473 59/249 (24%)
Tryp_SPc 52..264 CDD:238113 59/249 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147498
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.