DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Tmprss4

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_663378.1 Gene:Tmprss4 / 214523 MGIID:2384877 Length:435 Species:Mus musculus


Alignment Length:240 Identity:77/240 - (32%)
Similarity:117/240 - (48%) Gaps:25/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGITPVDASTLAVRLGTIN 92
            |::||.:.....:||..|::|||.|||.|:|:..:.|||||||....    :|.|:..||.|: |
Mouse   202 RVVGGVEAPVDSWPWQVSIQYNKQHVCGGSILDPHWILTAAHCFRKY----LDVSSWKVRAGS-N 261

  Fly    93 QYAGGSIVNVKSVII---HPSYGNFLHDIAILELDETLVFSDRIQDIALPPTTDEETEDVDAELP 154
            .......:.|..:.|   :|.|.. ..|||:::|...|.||..::.|.||.:        |..|.
Mouse   262 ILGNSPSLPVAKIFIAEPNPLYPK-EKDIALVKLQMPLTFSGSVRPICLPFS--------DEVLV 317

  Fly   155 NGTPVYVAGWG--ELSDGTASYKQQKANYNTLSRSLCEWEAGYGYE---SVVCLSRAE-GEGICR 213
            ..|||:|.|||  |.:.|..|....:|:...:..:.|..|..|..|   .::|....: |:..|:
Mouse   318 PATPVWVIGWGFTEENGGKMSDMLLQASVQVIDSTRCNAEDAYEGEVTAEMLCAGTPQGGKDTCQ 382

  Fly   214 GDAGAAVI--DDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTWI 256
            ||:|..::  .|...:.|:.|:..|..|...|.|.|:|:.||.||
Mouse   383 GDSGGPLMYHSDKWQVVGIVSWGHGCGGPSTPGVYTKVTAYLNWI 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 75/238 (32%)
Tryp_SPc 29..259 CDD:238113 76/239 (32%)
Tmprss4NP_663378.1 LDLa 56..90 CDD:238060
SRCR_2 106..195 CDD:295335
Tryp_SPc 202..427 CDD:214473 75/238 (32%)
Tryp_SPc 203..430 CDD:238113 76/239 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837546
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.