DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Prtn3

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_035308.2 Gene:Prtn3 / 19152 MGIID:893580 Length:254 Species:Mus musculus


Alignment Length:261 Identity:75/261 - (28%)
Similarity:112/261 - (42%) Gaps:44/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LGLLIFGLILSAEASPQGRILGGEDVAQGEYPWSASV---RYNKAHVCSGAIISTNHILTAAHCV 71
            |.|::.|.:   :||   :|:||.:......|:.||:   |:..:|.|.|.:|....:||||||:
Mouse    17 LALVVGGAV---QAS---KIVGGHEARPHSRPYVASLQLSRFPGSHFCGGTLIHPRFVLTAAHCL 75

  Fly    72 SSVGITPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSYGNF-----LHDIAILELDETLVFSD 131
            ..     :....:.|.||. :..........|..|......|:     |:|:.:|:|:.|.....
Mouse    76 QD-----ISWQLVTVVLGA-HDLLSSEPEQQKFTISQVFQNNYNPEENLNDVLLLQLNRTASLGK 134

  Fly   132 RIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQ---QKANYNTLSRSLCEWEA 193
            .:...:||        ..|..|..||.....|||.|  ||.:...   |:.|. |:...||.   
Mouse   135 EVAVASLP--------QQDQTLSQGTQCLAMGWGRL--GTQAPTPRVLQELNV-TVVTFLCR--- 185

  Fly   194 GYGYESVVC-LSRAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGS-KYPDVATRVSYYLTWI 256
                |..|| |......|||.||:|..:|.:. :|.|:.||....|.| ::||...|||.|:.||
Mouse   186 ----EHNVCTLVPRRAAGICFGDSGGPLICNG-ILHGVDSFVIRECASLQFPDFFARVSMYVDWI 245

  Fly   257 E 257
            :
Mouse   246 Q 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 68/240 (28%)
Tryp_SPc 29..259 CDD:238113 70/242 (29%)
Prtn3NP_035308.2 Tryp_SPc 29..245 CDD:214473 68/240 (28%)
Tryp_SPc 30..248 CDD:238113 70/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.