DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Klk1b8

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_032483.1 Gene:Klk1b8 / 16624 MGIID:892018 Length:261 Species:Mus musculus


Alignment Length:300 Identity:71/300 - (23%)
Similarity:112/300 - (37%) Gaps:104/300 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LIFGLILS---AEASP--QGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVS 72
            ||..|.||   .:|:|  |.|::||.:..:...||..:|..||.|:|.|.::..|.:||||||. 
Mouse     4 LILFLALSLGGIDAAPPLQSRVVGGFNCEKNSQPWQVAVYDNKEHICGGVLLERNWVLTAAHCY- 67

  Fly    73 SVGITPVDASTLAVRLGTINQYA-----------------------------GGSIVNVKSVIIH 108
                              ::||.                             ..|::.:|.:   
Mouse    68 ------------------VDQYEVWLGKNKLFQEEPSAQHRLVSKSFPHPGFNMSLLTLKEI--- 111

  Fly   109 PSYGNFLHDIAILELDETLVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTAS 173
            |...:|.:|:.:|.|.:....:|.::.|.||          ..|...|:....:|||.::    .
Mouse   112 PPGADFSNDLMLLRLSKPADITDAVKPITLP----------TKESKLGSTCLASGWGSIT----P 162

  Fly   174 YKQQKA--------------------NYNTLSRSLCEWEAGYGYESVVCLSRAEGEGICRGDAGA 218
            .|.||.                    |.......||..|            .:.|:.||:||:|.
Mouse   163 TKWQKPDDLQCVFLKLLPIKNCIENHNVKVTDVMLCAGE------------MSGGKNICKGDSGG 215

  Fly   219 AVIDDDKVLRGLTSFNFGPCGSK-YPDVATRVSYYLTWIE 257
            .:| .|.||:|:||....|||.. .|.:.|.:..:.:||:
Mouse   216 PLI-CDSVLQGITSTGPIPCGKPGVPAMYTNLIKFNSWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 61/277 (22%)
Tryp_SPc 29..259 CDD:238113 62/278 (22%)
Klk1b8NP_032483.1 Tryp_SPc 24..253 CDD:214473 61/277 (22%)
Tryp_SPc 25..256 CDD:238113 62/278 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837551
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.