DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Klk1b1

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_034775.1 Gene:Klk1b1 / 16623 MGIID:892019 Length:261 Species:Mus musculus


Alignment Length:272 Identity:80/272 - (29%)
Similarity:117/272 - (43%) Gaps:48/272 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LIFGLILS---AEASP--QGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVS 72
            ||..|.||   .:|:|  |.||:||....:...||..:|...|.::|.|.::..|.:||||||..
Mouse     4 LILFLALSLGGIDAAPPVQSRIVGGFKCEKNSQPWHVAVYRYKEYICGGVLLDANWVLTAAHCYY 68

  Fly    73 SVGITPVDASTLAVRLGTINQYAGGSIVN---VKSVIIHPSYGNFLH-------------DIAIL 121
            ...         .|.||..|.|.......   |....:||.|...||             |:.:|
Mouse    69 EKN---------NVWLGKNNLYQDEPSAQHRLVSKSFLHPCYNMSLHRNRIQNPQDDYSYDLMLL 124

  Fly   122 ELDETLVFSDRIQDIALPPTTDEETEDVDAELPN-GTPVYVAGWGELSDGTASYKQ--QKANYNT 183
            .|.:....:|.::.||||      ||:     |. |:....:|||.:......|.:  |..|...
Mouse   125 RLSKPADITDVVKPIALP------TEE-----PKLGSTCLASGWGSIIPVKFQYAKDLQCVNLKL 178

  Fly   184 LSRSLCEWEAGYGYESVVCLSRAEGEG--ICRGDAGAAVIDDDKVLRGLTSFNFGPCGS-KYPDV 245
            |....|:.........|:..:..:|.|  .|:||:|..:|.|. ||:||||:.:.|||. |.|.|
Mouse   179 LPNEDCDKAYVQKVTDVMLCAGVKGGGKDTCKGDSGGPLICDG-VLQGLTSWGYNPCGEPKKPGV 242

  Fly   246 ATRVSYYLTWIE 257
            .|::..:.:||:
Mouse   243 YTKLIKFTSWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 70/249 (28%)
Tryp_SPc 29..259 CDD:238113 71/251 (28%)
Klk1b1NP_034775.1 Tryp_SPc 24..253 CDD:214473 70/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837555
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.