DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and PRSS58

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001001317.1 Gene:PRSS58 / 136541 HGNCID:39125 Length:241 Species:Homo sapiens


Alignment Length:231 Identity:52/231 - (22%)
Similarity:92/231 - (39%) Gaps:63/231 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 CSGAIISTNHILTAAHCVSS-----VGIT-PVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSYG 112
            |:|.:|....::|||||...     :|:| |.|::...::           ::..:.:|.||.:.
Human    41 CAGVLIHPLWVITAAHCNLPKLRVILGVTIPADSNEKHLQ-----------VIGYEKMIHHPHFS 94

  Fly   113 --NFLHDIAILELDETLVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWG-ELSDGTASY 174
              :..|||.:::|......:|.::...||..|..|          .|...|:.|. .:.|   .|
Human    95 VTSIDHDIMLIKLKTEAELNDYVKLANLPYQTISE----------NTMCSVSTWSYNVCD---IY 146

  Fly   175 KQ----QKANYNTLSRSLCEWEAGYGY---ESVVCLSRAEGE-----------GICRGDAGAAVI 221
            |:    |..|.:.:|:..|. :|...|   |:::|:....|.           .||.|       
Human   147 KEPDSLQTVNISVISKPQCR-DAYKTYNITENMLCVGIVPGRRQPCKEVSAAPAICNG------- 203

  Fly   222 DDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTWIE 257
                :|:|:.||..|........:..::.||:.|||
Human   204 ----MLQGILSFADGCVLRADVGIYAKIFYYIPWIE 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 49/228 (21%)
Tryp_SPc 29..259 CDD:238113 52/231 (23%)
PRSS58NP_001001317.1 Tryp_SPc 29..234 CDD:214473 49/228 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147501
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.