DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Klk1b22

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_034244.1 Gene:Klk1b22 / 13646 MGIID:95291 Length:259 Species:Mus musculus


Alignment Length:288 Identity:72/288 - (25%)
Similarity:114/288 - (39%) Gaps:79/288 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ITLGLGLLIFGLILSAEASP--QGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAA 68
            :||.||        ..:|:|  |.|||||....:...||..:|.|...::|.|.::..|.:||||
Mouse     8 LTLSLG--------GIDAAPPVQSRILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWVLTAA 64

  Fly    69 HCVSS-----VGITPV--DASTLAVRLGTINQYAGGSIVNVKSVIIHPSYGNFL----------- 115
            ||...     :|...:  |..:...||             |.....||.:...|           
Mouse    65 HCYEDKYNIWLGKNKLFQDEPSAQHRL-------------VSKSFPHPDFNMSLLQSVPTGADLS 116

  Fly   116 HDIAILELDETLVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQQKAN 180
            :|:.:|.|.:....:|.::.|.||.|          |...|:....:|||.::.   ...|...:
Mouse   117 NDLMLLRLSKPADITDVVKPIDLPTT----------EPKLGSTCLASGWGSINQ---LIYQNPND 168

  Fly   181 YNTLSRSLCEWEAGYGYESVVC------------LSRAE---GEGICRGDAGAAVIDDDKVLRGL 230
            ...:|..|        :.:.||            |...|   |:..|:||:|..:|.|. ||:|:
Mouse   169 LQCVSIKL--------HPNEVCVKAHILKVTDVMLCAGEMNGGKDTCKGDSGGPLICDG-VLQGI 224

  Fly   231 TSFNFGPCGS-KYPDVATRVSYYLTWIE 257
            ||:...|||. ..|.:.|::..:.:||:
Mouse   225 TSWGSTPCGEPNAPAIYTKLIKFTSWIK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 63/261 (24%)
Tryp_SPc 29..259 CDD:238113 64/263 (24%)
Klk1b22NP_034244.1 Tryp_SPc 24..251 CDD:214473 63/261 (24%)
Tryp_SPc 25..254 CDD:238113 64/263 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837560
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.