DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Prss28

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:285 Identity:76/285 - (26%)
Similarity:126/285 - (44%) Gaps:44/285 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ITLGLGLL---IFGLILSAEASPQGRILGGEDVAQGEYPWSASVRY------NKAHVCSGAIIST 61
            :.|.|..|   :|...:|...|....|:||:....|::||..|:|.      :..|:|.|:||..
Mouse     5 LLLALSCLESTVFMASVSISRSKPVGIVGGQCTPPGKWPWQVSLRMYSYEVNSWVHICGGSIIHP 69

  Fly    62 NHILTAAHCVSSVGITPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSYGNF--LHDIAILELD 124
            ..|||||||:.|   ...|.:...|::|.:..|....::|:..:||||.|.:.  ..|:|:::|.
Mouse    70 QWILTAAHCIQS---QDADPAVYRVQVGEVYLYKEQELLNISRIIIHPDYNDVSKRFDLALMQLT 131

  Fly   125 ETLVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWG---------------ELSDGTASY 174
            ..||.|..:..::||  .|..|.|      :....::.|||               |:.......
Mouse   132 ALLVTSTNVSPVSLP--KDSSTFD------STDQCWLVGWGNLLQRVPLQPPYQLHEVKIPIQDN 188

  Fly   175 KQQKANYNTLSRSLCEWEAGYGYESVVCLSRAEGEGICRGDAGAAVI--DDDKVLR-GLTSFNFG 236
            |..|..|.  .:|..|.:|...::.::| :...|.|.|.||:|..::  ..:|.:: |:.|... 
Mouse   189 KSCKRAYR--KKSSDEHKAVAIFDDMLC-AGTSGRGPCFGDSGGPLVCWKSNKWIQVGVVSKGI- 249

  Fly   237 PCGSKYPDVATRVSYYLTWIEANTQ 261
            .|.:..|.:.:||...|.||..:.|
Mouse   250 DCSNNLPSIFSRVQSSLAWIHQHIQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 67/253 (26%)
Tryp_SPc 29..259 CDD:238113 69/255 (27%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 69/255 (27%)
Tryp_SPc 31..269 CDD:214473 67/252 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.