DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and KLK8

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_653088.1 Gene:KLK8 / 11202 HGNCID:6369 Length:305 Species:Homo sapiens


Alignment Length:245 Identity:66/245 - (26%)
Similarity:109/245 - (44%) Gaps:34/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGITPVDASTLAVRLG- 89
            :.::|||.:......||.|::...:..:|.|.::..|.:||||||         ......|||| 
Human    75 EDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHC---------KKPKYTVRLGD 130

  Fly    90 --TINQYAGGSIVNVKSVIIHPSYG-----NFLHDIAILELDETLVFSDRIQDIALPPTTDEETE 147
              ..|:......:.|...|.||.|.     :..||:.:|:|.:......:::.|:|   .|..|:
Human   131 HSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISL---ADHCTQ 192

  Fly   148 DVDAELPNGTPVYVAGWGELSDGTASYKQ--QKANYNTLSRSLCEWEA--GYGYESVVCLSRAEG 208
            .       |....|:|||.::....::..  ..|......:..|| :|  |...:.:||...::|
Human   193 P-------GQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCE-DAYPGQITDGMVCAGSSKG 249

  Fly   209 EGICRGDAGAAVIDDDKVLRGLTSFNFGPCG-SKYPDVATRVSYYLTWIE 257
            ...|:||:|..::.|. .|:|:||:...||| |..|.|.|.:..||.||:
Human   250 ADTCQGDSGGPLVCDG-ALQGITSWGSDPCGRSDKPGVYTNICRYLDWIK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 64/240 (27%)
Tryp_SPc 29..259 CDD:238113 66/242 (27%)
KLK8NP_653088.1 Tryp_SPc 77..297 CDD:214473 64/240 (27%)
Tryp_SPc 78..300 CDD:238113 66/242 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147503
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.