DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and KLK11

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_011524671.1 Gene:KLK11 / 11012 HGNCID:6359 Length:307 Species:Homo sapiens


Alignment Length:283 Identity:69/283 - (24%)
Similarity:122/283 - (43%) Gaps:55/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IFGLILSAEAS----PQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCV--- 71
            |..|||.|.|:    .:.||:.|.:......||.|::......:|...:|:...:||||||:   
Human    35 ILQLILLALATGLVGGETRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCLKPW 99

  Fly    72 ----SSVGITPVDASTLAVRLGTINQYAGGSIVNV-----------------KSVIIHPSYGNFL 115
                |...::| |.|:....|..:::|    ||::                 .....||.:.|.|
Human   100 VSLTSPTHVSP-DLSSSNYCLSHLSRY----IVHLGQHNLQKEEGCEQTRTATESFPHPGFNNSL 159

  Fly   116 ------HDIAILELDETLVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDG--TA 172
                  :||.::::...:..:..::.:.|      .:..|.|    ||...::|||..|..  ..
Human   160 PNKDHRNDIMLVKMASPVSITWAVRPLTL------SSRCVTA----GTSCLISGWGSTSSPQLRL 214

  Fly   173 SYKQQKANYNTLSRSLCE-WEAGYGYESVVCLSRAE-GEGICRGDAGAAVIDDDKVLRGLTSFNF 235
            .:..:.||...:....|| ...|...:::||.|..| |:..|:||:|..::.:.. |:|:.|:..
Human   215 PHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQS-LQGIISWGQ 278

  Fly   236 GPCG-SKYPDVATRVSYYLTWIE 257
            .||. ::.|.|.|:|..|:.||:
Human   279 DPCAITRKPGVYTKVCKYVDWIQ 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 61/262 (23%)
Tryp_SPc 29..259 CDD:238113 62/264 (23%)
KLK11XP_011524671.1 Tryp_SPc 53..300 CDD:214473 61/262 (23%)
Tryp_SPc 54..303 CDD:238113 62/264 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.