DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and LOC102554637

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_017448472.2 Gene:LOC102554637 / 102554637 RGDID:7618053 Length:246 Species:Rattus norvegicus


Alignment Length:274 Identity:72/274 - (26%)
Similarity:119/274 - (43%) Gaps:65/274 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLIFGLILSAEASP---QGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSS 73
            ||:..|:.:|.|.|   ..:|:||....:...|:..|:. :..|.|.|::|:...:::||||.. 
  Rat     4 LLVLVLVGAAVAFPVDDDDKIVGGYTCQEHSVPYQVSLN-SGYHYCGGSLINDQWVVSAAHCYK- 66

  Fly    74 VGITPVDASTLAVRLG--TINQYAGG-SIVNVKSVIIHPSYG--NFLHDIAILELDETLVFSDRI 133
                    |.:.||||  .||...|. ..||...:|.||::.  ...:||.:::|...:..:.|:
  Rat    67 --------SRIQVRLGEHNINVLEGDEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARV 123

  Fly   134 QDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQQKANYNTLSRSL---------- 188
            ..:|||.:.          .|.||...::|||                ||||..:          
  Rat   124 ATVALPSSC----------APAGTQCLISGWG----------------NTLSFGVNDPDLLQCLD 162

  Fly   189 ------CEWEAGYG---YESVVCLSRAE-GEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYP 243
                  .:.||.|.   ..::||....| |:..|:||:|..|:.:.: |:|:.|:.:|......|
  Rat   163 APLLPQADCEASYPGKITNNMVCAGFLEGGKDSCQGDSGGPVVCNGE-LQGIVSWGYGCALPDNP 226

  Fly   244 DVATRVSYYLTWIE 257
            .|.|:|..|:.||:
  Rat   227 GVYTKVCNYVDWIQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 64/252 (25%)
Tryp_SPc 29..259 CDD:238113 66/254 (26%)
LOC102554637XP_017448472.2 Tryp_SPc 24..242 CDD:238113 66/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.