DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and LOC101884131

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_017209773.1 Gene:LOC101884131 / 101884131 -ID:- Length:293 Species:Danio rerio


Alignment Length:270 Identity:62/270 - (22%)
Similarity:100/270 - (37%) Gaps:69/270 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EASPQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGITPVDASTLAV 86
            :||....:...||..:..:.|..|:..:..|.|:|.||....|||.||||:       |.....:
Zfish    63 DASGLDGLKSAEDDGKVPWLWHVSISLDSGHHCNGVIIQAQWILTNAHCVN-------DLDERLL 120

  Fly    87 RLGTINQYA-GGSIVNVKSVIIHPSY--GNFLHDIAILELDETLVFSDRIQDIALPPTTDEETED 148
            |:.::..:. ......|..|.::|.:  .:..:::|:|:|...|..|.|.|...||....|    
Zfish   121 RILSVTAHGLNKQTREVFRVFVNPQFNSSSLDYNVALLQLSSPLNLSGRTQPACLPSAGQE---- 181

  Fly   149 VDAELPNGTPVYVAGWGELSDGTASYKQQKANYNTLSRSLCE----------------------- 190
            :...|...|||:.        |..|..:|....:.:.|::||                       
Zfish   182 IPPSLQCWTPVWT--------GQMSGHEQWLKISVMERAVCEQHQRTRLTPTLLCAGLSSGDSGV 238

  Fly   191 --WEAGYGYESVVCLSRAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYL 253
              |.:|    |:.||:...|                .||.||.|:.....|::.|.|.:.|...:
Zfish   239 PYWNSG----SLYCLTNTSG----------------VVLMGLKSWGETYGGTQKPAVYSSVPATM 283

  Fly   254 TWIE--ANTQ 261
            .||.  .||:
Zfish   284 HWISQMLNTE 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 56/255 (22%)
Tryp_SPc 29..259 CDD:238113 58/259 (22%)
LOC101884131XP_017209773.1 Tryp_SPc 75..288 CDD:238113 57/251 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.