DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and tmprss9

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_002940084.3 Gene:tmprss9 / 100489279 XenbaseID:XB-GENE-993973 Length:1151 Species:Xenopus tropicalis


Alignment Length:252 Identity:70/252 - (27%)
Similarity:113/252 - (44%) Gaps:45/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHC-------------VSSVGITPV 79
            ||:||.|..:||:||..|:|.|..|.|...:|....:::||||             :::..::..
 Frog   234 RIVGGSDATKGEFPWQVSLRENNEHFCGATVIGDKWLVSAAHCFNDFQDPAVWVAYIATTSLSGT 298

  Fly    80 DASTLAVRLGTINQYAGGSIVNVKSVIIHPSY--GNFLHDIAILELDETLVFSDRIQDIALPPTT 142
            |:||:.              ..::::|.||||  ....:|:|:||||..|.|:...|.:.||..|
 Frog   299 DSSTVK--------------ATIRNIIKHPSYDPDTADYDVAVLELDSPLKFNKYTQPVCLPDPT 349

  Fly   143 DEETEDVDAELPNGTPVYVAGWGELSDGTASYKQ--QKANYNTLSRSLC-EWEAGYGYESVVCLS 204
            .        ..|.|....:.|||.|.:......:  |||....:.:||| ...:....|.::|..
 Frog   350 H--------VFPVGKKCIITGWGYLKEDNLVKPEVLQKATVAIMDQSLCNSLYSNVVTERMLCAG 406

  Fly   205 RAEGE-GICRGDAGAAVIDDDK----VLRGLTSFNFGPCGSKYPDVATRVSYYLTWI 256
            ..||: ..|:||:|..::.::.    .|.|:.|:..|...::.|.|..|||....||
 Frog   407 YLEGKIDSCQGDSGGPLVCEEPSGKFFLAGIVSWGVGCAEARRPGVYVRVSKIRNWI 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 68/250 (27%)
Tryp_SPc 29..259 CDD:238113 69/251 (27%)
tmprss9XP_002940084.3 SEA 60..156 CDD:396113
LDLa 186..221 CDD:238060
Tryp_SPc 234..463 CDD:214473 68/250 (27%)
Tryp_SPc 547..774 CDD:238113
LDLa 871..906 CDD:238060
Tryp_SPc 919..1145 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.