DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and LOC100485189

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_002941065.2 Gene:LOC100485189 / 100485189 -ID:- Length:249 Species:Xenopus tropicalis


Alignment Length:263 Identity:75/263 - (28%)
Similarity:121/263 - (46%) Gaps:41/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IFGLILSA------EASPQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVS 72
            :|.|.:||      :|....||:||.:......||..|:.|...|||.|.:|..|.:||||||  
 Frog     1 MFILFVSALLGTAVQARYYDRIIGGTECRPNSQPWHCSLYYFDQHVCGGVLIDENWVLTAAHC-- 63

  Fly    73 SVGITPVDASTLAVRLGTIN--QYAGGSIVN-VKSVIIHPSYG--NFLHDIAILELDETLVFSDR 132
                   ..|:|.||||..|  .|.|....: .:.:..|..:.  .|.:||.:|:|...:..:|.
 Frog    64 -------QLSSLQVRLGEHNLAVYEGKEQFSYAEKMCPHSGFNPITFDNDIMLLKLVSPVTINDY 121

  Fly   133 IQDIAL--PPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASY--KQQKANYNTLSRSLCE--W 191
            :|.|.|  |...|.||            ..|:|||..:....::  :.|.....|:|:..|:  :
 Frog   122 VQTIPLGCPTVGDGET------------CLVSGWGTTTSPEETFPDELQCVEVQTVSQDYCQGAF 174

  Fly   192 EAGYGYESVVCLSRAE-GEGICRGDAGAAVIDDDKVLRGLTSFNFGPCG-SKYPDVATRVSYYLT 254
            ......::::|....| |:..|:||:|..::.:..| .|:||:...||| :..|.:.|::..|:.
 Frog   175 PTDEITDNMLCAGVMEGGKDSCQGDSGGPLVCNSMV-HGITSWGNTPCGVANKPGIYTKICNYIA 238

  Fly   255 WIE 257
            ||:
 Frog   239 WIQ 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 68/240 (28%)
Tryp_SPc 29..259 CDD:238113 69/242 (29%)
LOC100485189XP_002941065.2 Tryp_SPc 22..243 CDD:238113 69/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.