DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and si:dkey-16l2.17

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_001341498.1 Gene:si:dkey-16l2.17 / 100001520 ZFINID:ZDB-GENE-141212-262 Length:305 Species:Danio rerio


Alignment Length:260 Identity:68/260 - (26%)
Similarity:119/260 - (45%) Gaps:52/260 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQG-RILGGEDVAQGEYPWSASVRY-NKAHVCSGAIISTNHILTAAHCVSSVGITPVDASTLAVR 87
            |.| ||:||.:.:.|.:||...::. :..|||.|:||:.|.:|:||||..:    |.:.|...:.
Zfish    27 PLGKRIVGGVEASPGSWPWQVDIQMGSNGHVCGGSIIAKNWVLSAAHCFPN----PSEVSAYTLY 87

  Fly    88 LGT-----INQYAGGSIVNVKSVIIHPSY----GNFLHDIAILELDETLVFSDRIQDIALPPTTD 143
            :|.     .||:.  .:..|:.|:|...|    |.  .|:|:::|...:.::||||.:.||    
Zfish    88 MGRHLLNGYNQFE--KVSYVQRVVIPEGYTDPQGG--RDVALVQLRAPVSWTDRIQPVCLP---- 144

  Fly   144 EETEDVDAELPNGTPVYVAGWGELSDG---TASYKQQKANYNTLSRSLCEWEAGYGYE------- 198
                ..|.:..:||..||.|||...:|   |.:...::.....:.:|.|:    :.|:       
Zfish   145 ----FADFQFNSGTLCYVTGWGHKQEGVSLTGAAALREVEVPIIDQSSCQ----FMYQILSSDSS 201

  Fly   199 ------SVVCLSRAE-GEGICRGDAGAAVI----DDDKVLRGLTSFNFGPCGSKYPDVATRVSYY 252
                  .::|....| |:..|:||:|..::    :...:..|:.||..|......|.:.:|||.:
Zfish   202 TVDILSDMICAGYKEGGKDSCQGDSGGPLVCPVGNGTWIQAGVVSFGLGCAQKNRPGIYSRVSSF 266

  Fly   253  252
            Zfish   267  266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 66/256 (26%)
Tryp_SPc 29..259 CDD:238113 65/255 (25%)
si:dkey-16l2.17XP_001341498.1 Tryp_SPc 32..273 CDD:238113 65/255 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.