DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and st14b

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_005161261.1 Gene:st14b / 777629 ZFINID:ZDB-GENE-061103-613 Length:864 Species:Danio rerio


Alignment Length:243 Identity:71/243 - (29%)
Similarity:115/243 - (47%) Gaps:19/243 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 HAQGRIMGGEDADATATTFTASLRV-DNAHVCGGSILSQTKILTTAHCVHRDG--KLIDASRLAC 82
            |...||:||:|:|.....:..||.: ...||||.|::|.:.::|.||||..:.  :...|.:...
Zfish   620 HKSSRIVGGKDSDEGEWPWQVSLHMKTQGHVCGASVISNSWLVTAAHCVQDNDQFRYSQADQWEV 684

  Fly    83 RVGSTNQYAGGKIV--NVESVAVHP--DYYNLNNNLAVITLSSELTYTDRITAIPLVASGEALPA 143
            .:|..||....|..  :|..:..||  |:.:.:|::|::.|.|.:|....|..|.|.......||
Zfish   685 YLGLHNQGETSKSTQRSVLRIIPHPQYDHSSYDNDIALMELDSPVTLNQNIWPICLPDPTHYFPA 749

  Fly   144 EGSEVIVAGWGRTSDGTNSYK--IRQISLKVAPEATCLDAYSDHDEQSFCLAHELKEG--TCHGD 204
             |..|.:.|||:..:|:::..  :::..:::.....|.....|........|..|..|  .|.||
Zfish   750 -GKSVWITGWGKLREGSDAVPSVLQKAEVRIINSTVCSKLMDDGITPHMICAGVLSGGVDACQGD 813

  Fly   205 GGG--GAIYGN---TLIGLTNFVVGACGSR-YPDVFVRLSSYADWIQE 246
            .||  .:|.||   .|.|:.::..| ||.| .|.|:.|::.|..||:|
Zfish   814 SGGPMSSIEGNGRMFLAGVVSWGDG-CGRRNRPGVYTRVTDYRSWIRE 860

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 64/222 (29%)
Tryp_SPc 42..244 CDD:214473 61/218 (28%)
st14bXP_005161261.1 SEA 92..180 CDD:279699
CUB 233..342 CDD:238001
CUB 351..457 CDD:238001
LDLa 465..497 CDD:238060
LDLa 499..533 CDD:238060
LDLa 536..570 CDD:238060
LDLa 578..613 CDD:238060
Tryp_SPc 624..858 CDD:214473 67/235 (29%)
Tryp_SPc 625..861 CDD:238113 69/238 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.