DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and ST14

DIOPT Version :10

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_068813.1 Gene:ST14 / 6768 HGNCID:11344 Length:855 Species:Homo sapiens


Alignment Length:131 Identity:24/131 - (18%)
Similarity:43/131 - (32%) Gaps:50/131 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IDVFLTLSAAFNQYVLFGYCGNSIDVPLECDDFKCTVNSCYYNYYLTQEQIVHFVIGAMTVILCA 115
            |::.:.||..|:.:|.|  .||.        :..|.:.:                       |..
Human   384 INILIPLSGRFDMFVRF--MGNF--------EKTCLIPN-----------------------LNV 415

  Fly   116 RLFIMYLTAKSEVTKFLSQATRVALLDSLTIFTFFILPSFAYAQFPATDFEIFGPLLALFKRVGA 180
            :|.|:...:.|...|    |.:|.|:....:            ::|..|.::. |:...|.|..|
Human   416 KLVILLFNSDSNPDK----AKQVELMRDYRV------------KYPKADMQVL-PVSGGFSRALA 463

  Fly   181 L 181
            |
Human   464 L 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 24/131 (18%)
ST14NP_068813.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SEA 88..>162 CDD:460188
CUB 227..332 CDD:238001
CUB 340..444 CDD:238001 17/108 (16%)
LDLa 454..486 CDD:238060 4/11 (36%)
LDLa 488..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060
Tryp_SPc 615..852 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.