DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG18754

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:260 Identity:55/260 - (21%)
Similarity:99/260 - (38%) Gaps:59/260 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIMGGEDADATATTFTASLRVDN-----------AHVCGGSILSQTKIL--------TTAHCVHR 70
            |..|.|:|:.....:...|..:|           ||...|..|:|..::        :|..|:..
  Fly   105 RDRGAENAELNEYPWMVLLLYENRLSLIRYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITS 169

  Fly    71 DGKLIDASRLACRVGSTNQY-----AGGKIVNVESVAVHPDYYNLNNNLAVITLSSELTYTDRIT 130
            :.:   ...|...||.|..:     :||               ...|::|::.|...:.||.:|.
  Fly   170 ESR---CPHLDVEVGQTTVHQGFTSSGG---------------TYRNDIALLRLQFPVRYTKKIQ 216

  Fly   131 AIPLVASGEALPAEGSEVIVAGWGRTSDGTNSYKIRQISLKVAPEATCLDAY-SDHDEQSFCLAH 194
            .|.|:.:  ..|.:...:.::||..|.   :|..:...::|....|.||:.| |.......|...
  Fly   217 PICLLDA--EFPLQDLNLQISGWDPTK---SSQTLITSTVKERNPADCLNRYPSFRSASQVCAGG 276

  Fly   195 ELKEGTCHGDGGGGAIYGNTLIGLTNFV----VGACGSRY------PDVFVRLSSYADWIQEQIA 249
            :.|..||.|. .|..:.|....|:..||    :.:.|.:|      |.|:.::..:::||:..:|
  Fly   277 QRKGDTCAGI-SGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKANLA 340

  Fly   250  249
              Fly   341  340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 50/239 (21%)
Tryp_SPc 42..244 CDD:214473 48/236 (20%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 53/253 (21%)
Tryp_SPc 108..335 CDD:214473 51/250 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436515
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.