DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG34458

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:263 Identity:66/263 - (25%)
Similarity:119/263 - (45%) Gaps:38/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVILGLIGLTAVGMCHA------QGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTT 64
            ||.|.:: |.||...|:      :.||:||:.|.........||:::..|.||||::|.|.|:|.
  Fly     7 LVKLSIL-LLAVTFVHSDMDVAEESRIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDTMIVTA 70

  Fly    65 AHCVHRDGKLIDASRLACRVGSTNQYAG-GKIVNVESVAVHPDY--YNLNNNLAVITLSSELTYT 126
            |||....    :..::...||:.:..|| |:..|:....:||.|  .:.:.::::|.|||.:...
  Fly    71 AHCTMGQ----NPGQMKAIVGTNDLSAGNGQTFNIAQFIIHPRYNPQSQDFDMSLIKLSSPVPMG 131

  Fly   127 DRITAIPLVASGEALPAEGSEVIVAGWGRTSDG---TNSYKIRQISL--------KVAPEATCLD 180
            ..:..|.| |..::..|..:..:::|:|..:..   .|..|..|:.|        :..|..|   
  Fly   132 GAVQTIQL-ADSDSNYAADTMAMISGFGAINQNLQLPNRLKFAQVQLWSRDYCNSQNIPGLT--- 192

  Fly   181 AYSDHDEQSFCLAHELKE-GTCHGDGGGGAIYGNTLIGLTNFVVGACGSR-YPDVFVRLSSYADW 243
                  ::..|..|...: .:|.||.||.......|.|:.::..| ||:: .|.::..:.:...|
  Fly   193 ------DRMVCAGHPSGQVSSCQGDSGGPLTVDGKLFGVVSWGFG-CGAKGRPAMYTYVGALRSW 250

  Fly   244 IQE 246
            |::
  Fly   251 IKQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 54/221 (24%)
Tryp_SPc 42..244 CDD:214473 52/217 (24%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 57/234 (24%)
Tryp_SPc 32..254 CDD:238113 58/237 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.