DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Klk4

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_064312.1 Gene:Klk4 / 56640 MGIID:1861379 Length:255 Species:Mus musculus


Alignment Length:240 Identity:61/240 - (25%)
Similarity:110/240 - (45%) Gaps:12/240 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIGLTAVGMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDGKLI 75
            ::.:|.........||:.|:|....:..:.|:|..::...|.|.::....:|:.|||:..  ..|
Mouse    17 ILEVTGASASSVSSRIIQGQDCSPHSQPWQAALFSEDGFFCSGVLVHPQWVLSAAHCLQE--SYI 79

  Fly    76 DASRLACRVGSTNQYAGGKIVNVESVAVHPDYY--NLNNNLAVITLSSELTYTDRITAIPLVASG 138
            ....|....||  |..|.:::.......||::.  :..|:|.:|.|:..:..::.|.:||:... 
Mouse    80 VGLGLHNLKGS--QEPGSRMLEAHLSIQHPNFNDPSFANDLMLIKLNESVIESNTIRSIPVATQ- 141

  Fly   139 EALPAEGSEVIVAGWGRTSDGTNSYKIRQISLKVAPEATCLDAYSD-HDEQSFCL-AHELKEGTC 201
              .|..|...:|:|||:..:|.....::.::|.||.|.||...|.. :....||. ..:.::.:|
Mouse   142 --CPTPGDTCLVSGWGQLKNGKLPSLLQCVNLSVASEETCRLLYDPVYHLSMFCAGGGQDQKDSC 204

  Fly   202 HGDGGGGAIYGNTLIGLTNFVVGACGS-RYPDVFVRLSSYADWIQ 245
            :||.||..:...:|.||.:...|.||. ..|.|:..|..:.:|||
Mouse   205 NGDSGGPIVCNRSLQGLVSMGQGKCGQPGIPSVYTNLCKFTNWIQ 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 55/209 (26%)
Tryp_SPc 42..244 CDD:214473 52/206 (25%)
Klk4NP_064312.1 Tryp_SPc 32..251 CDD:238113 59/225 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.