DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and AZU1

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001691.1 Gene:AZU1 / 566 HGNCID:913 Length:251 Species:Homo sapiens


Alignment Length:247 Identity:68/247 - (27%)
Similarity:108/247 - (43%) Gaps:17/247 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RLVILGLI-GLTAVGMCHAQG--RIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAH 66
            ||.:|.|: ||.|.....:..  .|:||..|......|.||::....|.|||:::....::|.|.
Human     3 RLTVLALLAGLLASSRAGSSPLLDIVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAAS 67

  Fly    67 CVHRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAV--HPDYYNLNNNLAVITLSSELTYTDRI 129
            |.......:....|........:....:..::.|::.  :....|| |:|.::.|..|...|..:
Human    68 CFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNL-NDLMLLQLDREANLTSSV 131

  Fly   130 TAIPLVASGEALPAEGSEVIVAGWG-RTSDGTNSYKIRQISLKVAPEATCLDAYSDHDEQSFCLA 193
            |.:||......:.| |:...||||| :.|.|..|...|.:::.|.||..|       ...:.|..
Human   132 TILPLPLQNATVEA-GTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQC-------RPNNVCTG 188

  Fly   194 HELKE-GTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWI 244
            ...:. |.|:||||...:......|:.:|.:|.|| |.||.|.|::.:.|||
Human   189 VLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCG-RGPDFFTRVALFRDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 55/207 (27%)
Tryp_SPc 42..244 CDD:214473 53/205 (26%)
AZU1NP_001691.1 Tryp_SPc 27..240 CDD:238113 61/223 (27%)
Possesses antibiotic activity. /evidence=ECO:0000269|PubMed:8506327 46..70 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.