DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and PRTN3

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_002768.3 Gene:PRTN3 / 5657 HGNCID:9495 Length:256 Species:Homo sapiens


Alignment Length:255 Identity:71/255 - (27%)
Similarity:117/255 - (45%) Gaps:38/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIGLTAVGMCHAQGRIMGGEDADATATTFTASLRV---DNAHVCGGSILSQTKILTTAHCVHRD- 71
            |:.|...|...| ..|:||.:|...:..:.|||::   ..:|.|||:::..:.:||.|||: || 
Human    14 LLALLLSGAARA-AEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCL-RDI 76

  Fly    72 -GKLIDASRLACRVGS---TNQYAGGKIVNVESVAVHP-DYYNLNNNLAVITLSSELTYTDRITA 131
             .:|::....|..|.:   |.|:     .:|..|.::. |..|..|::.:|.|||....:..:..
Human    77 PQRLVNVVLGAHNVRTQEPTQQH-----FSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVAT 136

  Fly   132 IPLVASGEALPAEGSEVIVAGWGRTSDGTNSYKIRQISLKVAPEATCLDAYSDHDEQSFCLAHEL 196
            :.|....:.:| .|::.:..||||.  |.:.           |.|..|...:......||..|.:
Human   137 VQLPQQDQPVP-HGTQCLAMGWGRV--GAHD-----------PPAQVLQELNVTVVTFFCRPHNI 187

  Fly   197 -------KEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSR-YPDVFVRLSSYADWIQEQI 248
                   |.|.|.||.||..|....:.|:.:||:..|.:| :||.|.|::.|.|||:..:
Human   188 CTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 62/221 (28%)
Tryp_SPc 42..244 CDD:214473 60/218 (28%)
PRTN3NP_002768.3 Tryp_SPc 28..246 CDD:238113 67/237 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.