DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and KLK10

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:218 Identity:52/218 - (23%)
Similarity:88/218 - (40%) Gaps:35/218 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 CGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGSTN--QYAGGKIVNVESVAVHPDYYNLN-- 111
            |.|.::.|:.:||.|||.::.        |..|||..:  ...|.::.......|||.|:..:  
Human    71 CAGVLVDQSWVLTAAHCGNKP--------LWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGP 127

  Fly   112 --------NNLAVITLSSELTYTDRITAIPLVASGEALP----AEGSEVIVAGWGRTSDGTNSYK 164
                    ::|.::.|:..:....|:.|:       .||    ..|.:..|||||.|:.....|.
Human   128 ILPRRTDEHDLMLLKLARPVVLGPRVRAL-------QLPYRCAQPGDQCQVAGWGTTAARRVKYN 185

  Fly   165 --IRQISLKVAPEATCLDAYSD-HDEQSFCLAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGAC 226
              :...|:.:.....|...|.. ......|...:..:..|..|.||..:...||.|:.::.|..|
Human   186 KGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPC 250

  Fly   227 GS-RYPDVFVRLSSYADWIQEQI 248
            || ::|.|:.::..|..||.:.|
Human   251 GSAQHPAVYTQICKYMSWINKVI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 51/215 (24%)
Tryp_SPc 42..244 CDD:214473 49/212 (23%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 51/215 (24%)
Tryp_SPc 49..269 CDD:214473 49/212 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.