DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and si:dkey-33m11.8

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_693464.3 Gene:si:dkey-33m11.8 / 565078 ZFINID:ZDB-GENE-141215-49 Length:251 Species:Danio rerio


Alignment Length:240 Identity:58/240 - (24%)
Similarity:111/240 - (46%) Gaps:36/240 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDGKLI-------DASRL 80
            |.||:||::....:..:.||::.:|.|.|||:::....:::.||| .|...||       |.|::
Zfish    21 QQRIIGGQEVQPYSIKYQASVQYNNYHYCGGTLIHPQWVVSAAHC-WRPSYLIKVVLSEHDLSKI 84

  Fly    81 ACRVGSTNQYAGGKIVNVESVAVH--PDYYNLNNNLAVITLS--SELTYTDRITAIPLVASGEAL 141
            .         ...::.||....||  .:|...::::.::.|.  :||:.|.:...:|:     ::
Zfish    85 E---------GFERVFNVSKALVHYMYNYRTFDSDIMLLKLEKPAELSATIQPAVLPV-----SV 135

  Fly   142 PA--EGSEVIVAGWGRTSDGTNSY----KIRQISLKVAPEATCLDAYSDHDEQSFCLAHEL-KEG 199
            ||  .|:..||:|||.|.  ..||    .:|.:.:::.|:......|...|.. .|....| .:.
Zfish   136 PALQGGTVCIVSGWGVTQ--VYSYYLSPVLRAVDVQIIPQCQYYYYYRITDNM-VCAGSPLGGKD 197

  Fly   200 TCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWI 244
            :|.||.||..|......|:.::.:....:.:|.|:.::.:|..|:
Zfish   198 SCQGDSGGPLICNGYFEGIVSWGISCANAYFPGVYTKVRNYIPWM 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 52/221 (24%)
Tryp_SPc 42..244 CDD:214473 51/219 (23%)
si:dkey-33m11.8XP_693464.3 Tryp_SPc 23..241 CDD:214473 56/235 (24%)
Tryp_SPc 24..241 CDD:238113 55/234 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.