DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Elane

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_056594.2 Gene:Elane / 50701 MGIID:2679229 Length:265 Species:Mus musculus


Alignment Length:237 Identity:63/237 - (26%)
Similarity:104/237 - (43%) Gaps:33/237 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVH----RDGKLIDASRLACRVGS 86
            |:||..|...|..|.|||:....|.||.:::::..:::.||||:    |..:::..:....|...
Mouse    29 IVGGRPARPHAWPFMASLQRRGGHFCGATLIARNFVMSAAHCVNGLNFRSVQVVLGAHDLRRQER 93

  Fly    87 TNQYAGGKIVNVESVAVHP-DYYNLNNNLAVITLSSELTYTDRITAIPLVASGEALPAEGSEVIV 150
            |.|     ..:|:.:..:. |...|.|::.:|.|:...|....:....|.|.|:.: .:.:..:.
Mouse    94 TRQ-----TFSVQRIFENGFDPSQLLNDIVIIQLNGSATINANVQVAQLPAQGQGV-GDRTPCLA 152

  Fly   151 AGWGRTSDGTNSYKIRQISLKVAPEATCLDAYSDHDEQSFC--------LAHELKEGTCHGDGGG 207
            .||||.  |||           .|..:.|...:.....:.|        |....:.|.|.||.||
Mouse   153 MGWGRL--GTN-----------RPSPSVLQELNVTVVTNMCRRRVNVCTLVPRRQAGICFGDSGG 204

  Fly   208 GAIYGNTLIGLTNFVVGACGS-RYPDVFVRLSSYADWIQEQI 248
            ..:..|.:.|:.:|:.|.||| .|||.|..::.:||||...|
Mouse   205 PLVCNNLVQGIDSFIRGGCGSGLYPDAFAPVAEFADWINSII 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 55/218 (25%)
Tryp_SPc 42..244 CDD:214473 53/215 (25%)
ElaneNP_056594.2 Tryp_SPc 28..242 CDD:214473 60/231 (26%)
Tryp_SPc 29..245 CDD:238113 62/234 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.