DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and try10

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001011209.1 Gene:try10 / 496640 XenbaseID:XB-GENE-6453489 Length:243 Species:Xenopus tropicalis


Alignment Length:256 Identity:67/256 - (26%)
Similarity:119/256 - (46%) Gaps:30/256 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVILGLIGLTAVGMCHAQGRIMGGEDADATATTFTASLRVDNA--HVCGGSILSQTKILTTAHCV 68
            |::..|:||..........:|:||...   :..:..||   ||  |.||||::::..:::.|||.
 Frog     4 LLLFSLLGLAVAQPIEDDDKIVGGYHC---SVPYQVSL---NAGYHFCGGSLINEHWVVSAAHCY 62

  Fly    69 HRDGKLIDASRLACRVGSTN-QYAGGKIVNVESVAV--HPDY--YNLNNNLAVITLSSELTYTDR 128
            .        |::..|:|..| :...|....::|..:  ||.|  :.::|::.:|.|.......:.
 Frog    63 Q--------SKMELRIGENNIELLEGTEQFIQSAKIIRHPQYNSWTIDNDIMLIQLQEPAQLNNE 119

  Fly   129 ITAIPLVASGEALPAEGSEVIVAGWGRT-SDGTNSYKIRQ-ISLKVAPEATCLDAY-SDHDEQSF 190
            :..|||...   .|..||..:::|||.| |:|.|...:.| |...:..:..|..:| ....:...
 Frog   120 VQPIPLPTE---CPPVGSICLISGWGNTLSNGVNYPDLLQCIEAPILSDQECRQSYPGSITDNMI 181

  Fly   191 CLAHELKEG--TCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQEQIA 249
            |:.: |:.|  :|.||.||..:....|.|:.::..|.....||.|:.::.:|..||::.||
 Frog   182 CVGY-LEGGIDSCQGDSGGPVVCDGELQGVVSWGRGCALPGYPGVYTKVCNYLSWIRDTIA 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 58/216 (27%)
Tryp_SPc 42..244 CDD:214473 56/213 (26%)
try10NP_001011209.1 Tryp_SPc 24..239 CDD:238113 61/232 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.