DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and zgc:92590

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001007055.1 Gene:zgc:92590 / 474322 ZFINID:ZDB-GENE-041024-15 Length:247 Species:Danio rerio


Alignment Length:257 Identity:69/257 - (26%)
Similarity:112/257 - (43%) Gaps:25/257 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RLVILGLIGLTAVGMCHAQGRIMGGEDADATATTFTASLRVDNA-HVCGGSILSQTKILTTAHCV 68
            ::::..|:.|...  |.|..:|:||.:....:..:...|..||. ..||.|:::....::.||| 
Zfish     2 KMIVFALLVLAVA--CSADDKIIGGYECSPNSQPWQIYLTYDNGQRWCGASLINDRWAVSAAHC- 63

  Fly    69 HRDGKLIDASRLACRVGSTN---QYAGGKIVNVESVAVHPDY--YNLNNNLAVITLSSELTYTDR 128
                 .:.|:||...:|..|   :....:.:..|.|..||.|  |.|:|:..:|.|.....:...
Zfish    64 -----YLVANRLTVHLGEHNVAVEEGTEQRIKAEKVIPHPKYNDYTLDNDFMLIKLKEPAVFNQY 123

  Fly   129 ITAIPLVASGEALPAEGSEVIVAGWGRTSDGTNSYK--IRQISLKVAPEATCLDAYS-DHDEQSF 190
            :..:||..|   ..:||.:.:|:|||...:....|.  ::.::|.|...|.|..||. ...:..|
Zfish   124 VQPVPLTTS---CSSEGEQCLVSGWGNLINTGVVYPDVLQCLNLPVLTRAQCEGAYGWQITKNMF 185

  Fly   191 CLAHELKEG---TCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQEQIA 249
            |..  ..||   .|.||.||..|....|.|:.::..|...|.||.|:..:..|.||:...||
Zfish   186 CAG--FMEGGKDACQGDSGGPVICNGELRGVVSWGYGCADSGYPGVYTEVCRYTDWVASTIA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 60/216 (28%)
Tryp_SPc 42..244 CDD:214473 59/213 (28%)
zgc:92590NP_001007055.1 Tryp_SPc 20..240 CDD:214473 62/230 (27%)
Tryp_SPc 21..243 CDD:238113 63/232 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.