DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Jon99Fi

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster


Alignment Length:246 Identity:73/246 - (29%)
Similarity:110/246 - (44%) Gaps:41/246 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QGRIMGGEDADATATTFTASLRVD-NAH-VCGGSILSQTKILTTAHC--------VHRDGKLIDA 77
            ||||..|..|......:...|... |.: .|||||:..|.:||.|||        ::....|.:.
  Fly    35 QGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQ 99

  Fly    78 SRLACRVGSTN-----QYAGGKIVNVESV--AVHPDYYNLNNNLAVITLSSEL-TYTDRITAIPL 134
            .:....|||.|     .|..|.:.|..|:  ..|.|:::|.|.:       || :|.||..    
  Fly   100 PQYTHWVGSGNFVQHHHYNSGNLHNDISLIRTPHVDFWHLVNKV-------ELPSYNDRYQ---- 153

  Fly   135 VASGEALPAEGSEVIVAGWGRTSDGTNSYK-IRQISLKVAPEATCLDAYSDHDEQSFCLAHELKE 198
                   ...|...:.:|||.|.||:.... ::.:.:::..::.|...:|.||.. .|:.....:
  Fly   154 -------DYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRTWSLHDNM-ICINTNGGK 210

  Fly   199 GTCHGDGGGGAI--YGNTLIGLTNFVVGA-CGSRYPDVFVRLSSYADWIQE 246
            .||.||.||..:  .||.|:|:|:||..| |.|..|.||.|::.|.|||::
  Fly   211 STCGGDSGGPLVTHEGNRLVGVTSFVSSAGCQSGAPAVFSRVTGYLDWIRD 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 67/227 (30%)
Tryp_SPc 42..244 CDD:214473 65/223 (29%)
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 69/240 (29%)
Tryp_SPc 38..262 CDD:238113 70/243 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471061
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.