DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Jon99Ci

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:277 Identity:82/277 - (29%)
Similarity:121/277 - (43%) Gaps:51/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LGLIGLTAVGMCHA--------------------QGRIMGGEDADATATTFTASLRVD---NAHV 50
            |.|:.|..:|:|.|                    :|||..|..|......:...:.::   |...
  Fly     4 LTLLSLAFLGVCSALTVPHSLVHPRDLEIRHGGIEGRITNGNLASEGQVPYIVGVSLNSNGNWWW 68

  Fly    51 CGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDYYNLNNNLA 115
            |||||:..|.:||.|||...    .|.:.|.....:.|:.|....|:.|:...:|.|..|:::||
  Fly    69 CGGSIIGHTWVLTAAHCTAG----ADEASLYYGAVNYNEPAFRHTVSSENFIRYPHYVGLDHDLA 129

  Fly   116 VITLSSELTYTDRITAIPLVASGEALPA--------EGSEVIVAGWGRTSDGTNSYK-IRQISLK 171
            :|.       |..:....||...| ||:        |.:.|..||||...||:|..: :|.:.||
  Fly   130 LIK-------TPHVDFYSLVNKIE-LPSLDDRYNSYENNWVQAAGWGAIYDGSNVVEDLRVVDLK 186

  Fly   172 VAPEATCLDAYSDHD---EQSFCLAHELKEGTCHGDGGGGAI--YGNTLIGLTNFVVG-ACGSRY 230
            |...|.| .||...|   |.:.|:.....:.||.||.||..:  .|:.|||:|:||.. .|....
  Fly   187 VISVAEC-QAYYGTDTASENTICVETPDGKATCQGDSGGPLVTKEGDKLIGITSFVSAYGCQVGG 250

  Fly   231 PDVFVRLSSYADWIQEQ 247
            |..|.|::.|.:||:|:
  Fly   251 PAGFTRVTKYLEWIKEE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 70/222 (32%)
Tryp_SPc 42..244 CDD:214473 68/219 (31%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 72/236 (31%)
Tryp_SPc 41..266 CDD:238113 73/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471076
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.