DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Jon99Cii

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster


Alignment Length:257 Identity:74/257 - (28%)
Similarity:114/257 - (44%) Gaps:45/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LTAVGMCHAQGRIMGGEDADATATTFTASLRVD-NAH-VCGGSILSQTKILTTAHCVHRDGKLID 76
            ||...:...||||..|..|......:...|... |.: .|||||:..|.:||.|||.:      .
  Fly    24 LTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTN------G 82

  Fly    77 ASRLACRVGS--------TNQYAGGKIVNVESVAVHPDYY--NLNNNLAVITLSSELTYTDRITA 131
            ||.:....|:        |:....|.|:.      |..|.  ||:|::::|.       |..:..
  Fly    83 ASGVTINYGASIRTQPQYTHWVGSGDIIQ------HHHYNSGNLHNDISLIR-------TPHVDF 134

  Fly   132 IPLVASGEALPA--------EGSEVIVAGWGRTSDGTNSYK-IRQISLKVAPEATCLDAYSDHDE 187
            ..||...| ||:        .|...:.:|||.|.||:.... ::.:.:::..::.|...:|.||.
  Fly   135 WSLVNKVE-LPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCSRTWSLHDN 198

  Fly   188 QSFCLAHELKEGTCHGDGGGGAIY--GNTLIGLTNFVVGA-CGSRYPDVFVRLSSYADWIQE 246
            . .|:..:..:.||.||.||..:.  ||.|:|:|:|...| |.|..|.||.|::.|.|||::
  Fly   199 M-ICINTDGGKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGCQSGAPAVFSRVTGYLDWIRD 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 66/229 (29%)
Tryp_SPc 42..244 CDD:214473 64/225 (28%)
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 69/245 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471065
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.