DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG11843

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:257 Identity:57/257 - (22%)
Similarity:102/257 - (39%) Gaps:43/257 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IMGGEDADATATTFTASL--------RVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLA- 81
            |:||..|........|.|        |.|  ..|||.::|:..:||.|||:..:...::..||. 
  Fly    68 IVGGHPAQPREFPHMARLGRRPDPSSRAD--WFCGGVLISERFVLTAAHCLESERGEVNVVRLGE 130

  Fly    82 CRVGSTNQYAGGKIVNVESVAVHPDYYN--LNNNLAVITLSSELTYTDRITAIPLVASGEALPAE 144
            ....|.::.|..:...|.....||.|.:  ..:::.::.|:..:.:       .|......||.:
  Fly   131 LDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVF-------DLYKHPACLPFQ 188

  Fly   145 ----GSEVIVAGWGRTSDGTN-SYKIRQISLKVAPEATCLDAYSDHDEQ---------SFCLAHE 195
                ....|..|||.|..... |.::.::.|:......|....:...|:         ..|:..|
  Fly   189 DERSSDSFIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSE 253

  Fly   196 LKEGTCHGDGGGGAIYGN-------TLIGLTNFVVGACGS-RYPDVFVRLSSYADWIQEQIA 249
            :.:.||:||.||..:..:       .::|:|:..: :||| ..|.::.|:..|..||...:|
  Fly   254 MAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGL-SCGSPGIPGIYTRVYPYLGWIARTLA 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 51/237 (22%)
Tryp_SPc 42..244 CDD:214473 49/234 (21%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 56/253 (22%)
Tryp_SPc 68..309 CDD:214473 54/250 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437181
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.