DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG11842

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:256 Identity:61/256 - (23%)
Similarity:113/256 - (44%) Gaps:43/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IMGGEDADATATTFTASLRV----DNAHV---CGGSILSQTKILTTAHCVHRDGKLIDASRLA-C 82
            |:||  ..|....|..:.|:    :|..|   |||:::|...:||.|||.:.....::.:||. .
  Fly    73 IIGG--GPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSVNIARLGDL 135

  Fly    83 RVGSTNQYAGGKIVNVESVAVHPD--YYNLNNNLAVITLSSELTYTDRITAIPLVASGEALPAE- 144
            ...:.|..|..:..:|:....||:  |..:.|:::|:.||..:|:.|       ......||.: 
  Fly   136 EFDTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFND-------YKHPACLPFDD 193

  Fly   145 ---GSEVIVAGWGRTS--DGTNSYKIRQISLKVAPEATCLDAYSDHDEQ---------SFCLAHE 195
               |:..|..|||:..  ..|.:.|::::  |:....|.....:|.:::         ..|:...
  Fly   194 GRLGTSFIAIGWGQLEIVPRTENKKLQKV--KLYNYGTRCRITADRNDELPEGYNATTQLCIGSN 256

  Fly   196 LKEGTCHGDGGGGAIYGNT-------LIGLTNFVVGACGSRYPDVFVRLSSYADWIQEQIA 249
            ..:.||:||.||..:..:.       ::|:|:..|.......|.::.|:..|.|||::|:|
  Fly   257 EHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIGVACDTPDLPAMYTRVHFYLDWIKQQLA 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 54/236 (23%)
Tryp_SPc 42..244 CDD:214473 52/233 (22%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 59/252 (23%)
Tryp_SPc 73..312 CDD:214473 57/249 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437179
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.