DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG34129

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster


Alignment Length:241 Identity:51/241 - (21%)
Similarity:96/241 - (39%) Gaps:35/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIMGGEDADATATTFTA-SLRV---DNAHVCGGSILSQTKILTTAHCVH-----RDGKLIDASRL 80
            |:.||..:: |...|.. .||:   |....||.:..:...::|:|:|::     .:|..::.:..
  Fly    39 RVWGGVQSN-TGPNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTAF 102

  Fly    81 A-CRVGSTNQYAGGKIVNVESVAVHPD---YYNLNNNLAVITLSSELTYTDRITAIPLVASGEAL 141
            : |   ....||     :::::. .|:   |..|..::||:.|...:  ..|:|....:.|.:..
  Fly   103 SEC---DRENYA-----DIDTIQ-FPEKFIYQKLYMDVAVVRLRDPV--RGRLTEFIRLCSVKVQ 156

  Fly   142 PAEGSEVIVAGWGRTSDGTN----SYKIRQISLKVAPEATCLDAYSDHD--EQSFCLAHELKEGT 200
            |.  .:::|.|||  .|.|.    |...|.:::.:.....|...:....  ..|.|.........
  Fly   157 PK--MQMVVFGWG--FDNTEVEIPSSDPRNVTVTIISIKECRQKFKSPKIASTSICARQPKNPKQ 217

  Fly   201 CHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQE 246
            |..|||...|||..|.|:.:|......:..|.::..:.....:|.|
  Fly   218 CLYDGGSPLIYGRELCGVVSFGSHCIDTSRPGMYTNIRRVKRFITE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 46/223 (21%)
Tryp_SPc 42..244 CDD:214473 44/219 (20%)
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 49/237 (21%)
Tryp_SPc 55..261 CDD:304450 44/220 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.