DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG10232

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:275 Identity:65/275 - (23%)
Similarity:114/275 - (41%) Gaps:54/275 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TAVGMCHAQGRIMGGEDADATATTFTASLRVDNAHV------CGGSILSQTKILTTAHCVHRDGK 73
            |:.|......|:..|..|......:.|.|..:|..:      |.||::::..:||.||||.:| |
  Fly   246 TSCGQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKD-K 309

  Fly    74 LIDASRLACRVG------STN---QYAGGKI-----VNVESVAVHPDYYN---LNNNLAVITLSS 121
            :::...:..||.      :||   .:.|...     :.:|...||..|:|   ..:::|::.|.:
  Fly   310 MVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIALVRLQT 374

  Fly   122 ELTYTDRITAIPLVASGEALPAEGSEVIVAGWGRTSDGTNSYKIRQISLKVAPEATCLDAYSDHD 186
            .:.||..|  :|:....:.:|.....:.:||||.|       |.|:.|..:.......:.|...|
  Fly   375 PVRYTHEI--LPICVPKDPIPLHNHPLQIAGWGYT-------KNREYSQVLLHNTVYENRYYCQD 430

  Fly   187 EQSF-------CLAHELKEGTCHGDGGG-----------GAIYGNTLIGLTNFVVGACGSRYPDV 233
            :.||       |.:....|.:|.||.||           ..:|   |.|:.::....||.|.|.|
  Fly   431 KISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVY---LAGIVSYGSENCGDRKPGV 492

  Fly   234 FVRLSSYADWIQEQI 248
            :.:..::..||:..:
  Fly   493 YTKTGAFFSWIKANL 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 59/245 (24%)
Tryp_SPc 42..244 CDD:214473 57/242 (24%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 62/258 (24%)
Tryp_SPc 260..503 CDD:214473 60/255 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436517
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.