DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and SPE

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:247 Identity:62/247 - (25%)
Similarity:106/247 - (42%) Gaps:63/247 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 CGGSILSQTKILTTAHC-----VHRDGKLIDASRLA---------CRVGSTNQYAGGKI------ 95
            |||::|:...:||..||     :.:.|.::.:.||.         |    |.|..|.:|      
  Fly   166 CGGALLNSRYVLTAGHCLASRELDKSGAVLHSVRLGEWDTRTDPDC----TTQMNGQRICAPKHI 226

  Fly    96 -VNVESVAVH----PDYYNLNNNLAVITLSSELTYTDRITAIPLVASGEALPAEG--------SE 147
             :.||...:|    |:..:..|::|::.|...::|||.:..|       .||.:|        ..
  Fly   227 DIEVEKGIIHEMYAPNSVDQRNDIALVRLKRIVSYTDYVRPI-------CLPTDGLVQNNFVDYG 284

  Fly   148 VIVAGWGRTSDGTNSYKIRQISLKVAPEATCLDAYSDH----DEQSFCLAHELKEGTCHGDGGG- 207
            :.|||||.|.:...|....:|::.|....:|.:.||..    |:...|...:|...||.||.|| 
  Fly   285 MDVAGWGLTENMQPSAIKLKITVNVWNLTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGP 349

  Fly   208 ----------GAIYGNTLIGLTNFVVGACGSR-YPDVFVRLSSYADWIQEQI 248
                      ...|   :.|:|::....||.: :|.|:.|..::.|||::::
  Fly   350 LMVPISTGGRDVFY---IAGVTSYGTKPCGLKGWPGVYTRTGAFIDWIKQKL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 62/244 (25%)
Tryp_SPc 42..244 CDD:214473 60/241 (25%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 62/244 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436524
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.