DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG16710

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:269 Identity:62/269 - (23%)
Similarity:108/269 - (40%) Gaps:60/269 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIMGGEDADATATTFTA-------SLRVDNAHV---CGGSILSQTKILTTAHCVHRDGKLIDASR 79
            ||.|||:.......:.|       |..|.|..:   |.||:::...:||.|||:...|  :|..|
  Fly   105 RIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHCLRITG--LDLRR 167

  Fly    80 LACRVGSTNQYAGGKIVNVESVAVH--PDYYNLN------------------NNLAVITLSSELT 124
            :  |:|..|..:....|...:...|  |::..::                  |::|::.|...:.
  Fly   168 V--RLGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIKHRHYMVFEERPYNDIALLRLKFPVR 230

  Fly   125 YTDRITAI----PLVASGEALPAEGSEVIVAGWGRTSDGTNSYKIRQ--ISLKVAPEATCLDAYS 183
            ||.:|..|    ..:.|..:.  ...::.:||||.:.....|..:.|  ::.:.|.|.:..:...
  Fly   231 YTAQIKPICVQLDYIFSNPSF--SNHKLQIAGWGLSHKQGYSNVLLQAYVNGRNADECSLSEPSL 293

  Fly   184 DHDEQSFCLAHEL-KEGTCHGDGGGGA-----------IYGNTLIGLTNFVVGACGSRY-PDVFV 235
            ..|:::...|..| ...||.||.||..           :|   |.|:|::....||  | |..:.
  Fly   294 GLDKETHICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVY---LAGITSYGYSQCG--YGPAAYT 353

  Fly   236 RLSSYADWI 244
            :.|.:.:||
  Fly   354 KTSKFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 56/245 (23%)
Tryp_SPc 42..244 CDD:214473 54/243 (22%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 60/267 (22%)
Tryp_SPc 106..362 CDD:238113 59/266 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436518
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.