DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG31266

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:292 Identity:79/292 - (27%)
Similarity:120/292 - (41%) Gaps:80/292 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VILGLIGLTAVGMCHA------------------------QGRIMGGEDADATATTFTASLRVDN 47
            |:|||..|...|...|                        |||::||..|......:.||  :.|
  Fly     9 VLLGLTLLALQGPTEAMRMRGEPLPGLANIERHRSTEAVPQGRVIGGTTAAEGNWPWIAS--IQN 71

  Fly    48 A---HVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDYYN 109
            |   |:||..||.:|.:||.|.||                      ||.:.:|:..|....|:::
  Fly    72 AYSYHLCGAIILDETWVLTAASCV----------------------AGLRPLNLLVVTGTVDWWD 114

  Fly   110 L---------------------NNNLAVITLSSELTYTDRITAIPLVASGEALPAEGSEVIVAGW 153
            |                     :|::|::.|||::.:.|....|.|....|.  .||.::..|||
  Fly   115 LYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDEL--EEGDKLTFAGW 177

  Fly   154 GRT-SDGTNSYKIRQISLKVAPEATCLDAYSDHDEQSF---CLAHELKEGTCHGDGGGGAI-YGN 213
            |.: :.||....:::.|....|...|.:...:.|:...   |:..:..:|.||||.||..| ...
  Fly   178 GSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQGACHGDTGGPLIDEQQ 242

  Fly   214 TLIGLTNFVVGACGSRYPDVFVRLSSYADWIQ 245
            .|:|:.|:.| .||..||||:.|.:.|.|||:
  Fly   243 RLVGIGNWGV-PCGRGYPDVYARTAFYHDWIR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 65/233 (28%)
Tryp_SPc 42..244 CDD:214473 63/230 (27%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 68/247 (28%)
Tryp_SPc 52..275 CDD:238113 69/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.