DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG17475

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:242 Identity:63/242 - (26%)
Similarity:105/242 - (43%) Gaps:31/242 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QGRIMGGEDADATATTFTASLR-VDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGS 86
            |.|::.|||.......:..||: :...|:|||.|:.:..:||.||||:.    .:.:.|....|:
  Fly    47 QNRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYG----YNPTYLRVITGT 107

  Fly    87 TNQYAGGKIVNVESVAVH-----PDYYNLNNNLAVITLS-----SELTYTDRITAIPLVASGEAL 141
            ........:..||...:|     |||:   |::|:|.|:     :|.|....:...|:       
  Fly   108 VEYEKPDAVYFVEEHWIHCNYNSPDYH---NDIALIRLNDTIKFNEYTQPAELPTAPV------- 162

  Fly   142 PAEGSEVIVAGWGRTS-DGTNSYKIRQISLKVAPEATCLDAYSDHDEQSFCLAHELK---EGTCH 202
             |.|:::::.|||.|. .|.....:::..|.....:||.:..::......|....|.   :|.||
  Fly   163 -ANGTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQGACH 226

  Fly   203 GDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQEQIA 249
            ||.||...:...|.||.|:.. .|....||....:..|.:||:..|:
  Fly   227 GDSGGPLTHNGVLYGLVNWGY-PCALGVPDSHANVYYYLEWIRSMIS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 57/219 (26%)
Tryp_SPc 42..244 CDD:214473 55/216 (25%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 59/233 (25%)
Tryp_SPc 50..269 CDD:238113 60/234 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436918
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.