DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG17477

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:237 Identity:64/237 - (27%)
Similarity:117/237 - (49%) Gaps:24/237 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IMGGEDADATATTFTASLR-VDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGSTNQ 89
            |:||::|......:..||: :..:|:|||:|:|...|:|..|||    |....|||....|:...
  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCV----KGYPTSRLQVATGTIRY 87

  Fly    90 YAGGKIVNVESVAVHPDYYN--LNNNLAVITLSSELTYTDRITAIPLVASGEALPAEGSEVIVAG 152
            ...|.:...:::.:|.:|.:  ..|::.::.|:..:|:.....|:.|..|  ..|...||::..|
  Fly    88 AEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTS--PFPRGASELVFTG 150

  Fly   153 WG-RTSDGTNSYKIRQISLKVAPEATC---LDAYSD------HDEQSFCLAHELKEGTCHGDGGG 207
            || :::.|:...:::::..:......|   :.||.|      |    .|...:...|.||||.||
  Fly   151 WGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCH----ICAYRQANIGACHGDSGG 211

  Fly   208 GAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQEQIA 249
            ..::..||:|:.||.| .|....||:|:.:..|.||:::.::
  Fly   212 PLVHQGTLVGILNFFV-PCAQGVPDIFMNIMYYRDWMRQTMS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 60/217 (28%)
Tryp_SPc 42..244 CDD:214473 59/214 (28%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 64/233 (27%)
Tryp_SPc 27..246 CDD:214473 62/229 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.