DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG31326

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:223 Identity:61/223 - (27%)
Similarity:106/223 - (47%) Gaps:27/223 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 AHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGSTNQ--YAGGKIVNVESVAVHPDY--- 107
            |.:|||:::|.:.:|:.|||....|:.:.|||||..:|....  ::.|:...|..:.:|.::   
  Fly   301 AFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLGRNTLAIHSDGEFRGVSQLIIHENFQFK 365

  Fly   108 YNLNNNLAVITLSSELTYTDRITAIPLVASGEA--LPAEGSEVIVAGWGRTSDGTNSYKIRQIS- 169
            .....:||::.|...:.|||.|..|.|.::...  || :|.:..|||||....||.:.::.::: 
  Fly   366 QFTEADLALVRLDEPVRYTDYIVPICLWSTSNRMDLP-QGLKSYVAGWGPDETGTGNTEVSKVTD 429

  Fly   170 LKVAPEATC-LDAYSDHDEQSFCLAHELKEGTCHGDGGG-------------GAIYGNTLIGLTN 220
            |.:..||.| |:......:.|...|.:...|.|..||||             |.|.|    |:.|
  Fly   430 LNIVSEANCALELPHVLVQPSSLCAKKTGAGPCASDGGGPLMLREQDVWVLRGVISG----GVIN 490

  Fly   221 FVVGACGSRYPDVFVRLSSYADWIQEQI 248
            .....|....|.||..::.:.:|:::::
  Fly   491 EKENTCELSKPSVFTDVAKHIEWVRQKM 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 61/220 (28%)
Tryp_SPc 42..244 CDD:214473 60/217 (28%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 61/220 (28%)
Tryp_SPc 277..514 CDD:214473 60/217 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471161
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.