DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG9649

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:222 Identity:51/222 - (22%)
Similarity:98/222 - (44%) Gaps:27/222 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 DNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVG--STNQYAGGKIVNVESVAVHPDYY 108
            |...:|||:::|...:::.|||.....:.:...|....:|  |.:.::.|..:.|..:.:| :.|
  Fly   281 DYNFLCGGTLISARTVISAAHCFRFGSRNLPGERTIVSLGRNSLDLFSSGATLGVARLLIH-EQY 344

  Fly   109 NLN----NNLAVITLSSELTYTDRITAIPLVASGE----ALPAEGSEVIVAGWGRTSDGTNSYKI 165
            |.|    .:||::.||:.:...|.|.  |:....|    .||: |.:..|||||....|..:.::
  Fly   345 NPNVYTDADLALLQLSNHVDIGDYIK--PICLWNENFLLELPS-GHKSYVAGWGEDEKGNRNTRL 406

  Fly   166 RQIS-LKVAPEATCLDAYSDHD-----EQSFCLAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVG 224
            .::: ..:..:..|....|:.:     ..:.|.::....|.|.||.|||.:.....|.:...||.
  Fly   407 AKMTDTDIITQWECRGNLSEENAKFITSHTICASNAQASGPCSGDSGGGLMLQEQDIWMLRGVVS 471

  Fly   225 A-------CGSRYPDVFVRLSSYADWI 244
            |       |....|.::..::.:.:|:
  Fly   472 AGQRMTNRCNLTLPVIYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 51/222 (23%)
Tryp_SPc 42..244 CDD:214473 50/220 (23%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 50/220 (23%)
Tryp_SPc 259..497 CDD:214473 50/219 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471103
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.