DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and snk

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:221 Identity:68/221 - (30%)
Similarity:106/221 - (47%) Gaps:31/221 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 CGGSILSQTKILTTAHCVHRDGKLIDASRLACR-VGSTNQYAGGKIVNVESVAVHPDYYN--LNN 112
            |||:::|:..:||.|||.....|..|..||..| :..|:  |..:.:.:..:.:||.|.:  ..:
  Fly   220 CGGALVSELYVLTAAHCATSGSKPPDMVRLGARQLNETS--ATQQDIKILIIVLHPKYRSSAYYH 282

  Fly   113 NLAVITLSSELTYTDRITAIPLVASGE-ALPAEGSEVIVAGWGRTSD-GTNSYKIRQISLKVAPE 175
            ::|::.|:..:.:::::....|....| .:|.    |:.||||||.. |..|..:||:.|.|.|:
  Fly   283 DIALLKLTRRVKFSEQVRPACLWQLPELQIPT----VVAAGWGRTEFLGAKSNALRQVDLDVVPQ 343

  Fly   176 ATCLDAYSDHD-------EQSFCLAHELKEG--TCHGDGGGGAIYG--------NTLIGLTNFVV 223
            .||...|....       |..||..: |..|  ||.|| .||.|:.        ..::|:|:|..
  Fly   344 MTCKQIYRKERRLPRGIIEGQFCAGY-LPGGRDTCQGD-SGGPIHALLPEYNCVAFVVGITSFGK 406

  Fly   224 GACGSRYPDVFVRLSSYADWIQEQIA 249
            .......|.|:.||.||.||| |:||
  Fly   407 FCAAPNAPGVYTRLYSYLDWI-EKIA 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 65/217 (30%)
Tryp_SPc 42..244 CDD:214473 63/214 (29%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 66/218 (30%)
Tryp_SPc 186..427 CDD:214473 63/214 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437068
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.