DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and MP1

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:267 Identity:69/267 - (25%)
Similarity:117/267 - (43%) Gaps:48/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIMGGEDADATATTFTASLRVD-----NAHVCGGSILSQTKILTTAHCVH-----------RDGK 73
            |::||.:.......:.|.:...     ..|.||||:::...:||.||||.           |.|:
  Fly   137 RVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELTGVRLGE 201

  Fly    74 LIDASRLACRVGSTNQYAGGKIVN-------VESVAVHPDYYNLN----NNLAVITLSSELTYTD 127
            ...::...|.||..    |.:..|       ||....||.|...:    |::|::.|..|:.|:|
  Fly   202 WDASTNPDCTVGKN----GRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQYSD 262

  Fly   128 RI--TAIPLVASGEALPAEGSEVIVAGWGRT-SDGTNSYKIRQISLKVAPEATCLDAYSDH---- 185
            .|  ..:|.:||.......|.:|:||||||| ::.|::.|:: ..|...|.:.|...|:..    
  Fly   263 FILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLK-AELDTVPTSECNQRYATQRRTV 326

  Fly   186 DEQSFCLAHELKEGTCHGDGGGGAIY-----GNT---LIGLTNFVVGACGSR-YPDVFVRLSSYA 241
            ..:..|........:|.||.||..:.     ||:   :.|:.::....||.: :|.|:.|:.:|.
  Fly   327 TTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYL 391

  Fly   242 DWIQEQI 248
            :||:..:
  Fly   392 NWIENNV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 65/247 (26%)
Tryp_SPc 42..244 CDD:214473 63/244 (26%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 67/261 (26%)
Tryp_SPc 138..397 CDD:238113 68/263 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436523
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.