DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG10587

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:251 Identity:64/251 - (25%)
Similarity:112/251 - (44%) Gaps:36/251 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QGRIMGGE-DADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDGKLID------ASRL 80
            |.|::||: ..:|....:..:||.:...||||::|....:||.|||.....|:.|      ||:|
  Fly    43 QTRVVGGDVTTNAQLGGYLIALRYEMNFVCGGTLLHDLIVLTAAHCFLGRVKISDWLAVGGASKL 107

  Fly    81 ACRVGSTNQYAGGKIVNVESVAVHPDYYNLNNNLAVITLSSELTYTDRITAIPLVASGEALPAEG 145
            ..| |...|.   |.| ::|.....|  ::|.::|::.|...:  ..:.....::...:.:|  |
  Fly   108 NDR-GIQRQV---KEV-IKSAEFRED--DMNMDVAILRLKKPM--KGKSLGQLILCKKQLMP--G 161

  Fly   146 SEVIVAGWGRT--SDGTNSYKIRQISLKVAPEATCLDAYSDHDEQS----------------FCL 192
            :|:.|:|||.|  |:......:|.:::.|..:..|..:|...|.:|                ||.
  Fly   162 TELRVSGWGLTENSEFGPQKLLRTVTVPVVDKKKCRASYLPTDWESHKHFDLFLKVHLTDSMFCA 226

  Fly   193 AHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQEQI 248
            ....|:..|..|.||..:|.|.:.|:.:|.:|....||..|:..:.....:|::.|
  Fly   227 GVLGKKDACTFDSGGPLVYKNQVCGIVSFGIGCASKRYYGVYTDIMYVKPFIEQSI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 58/228 (25%)
Tryp_SPc 42..244 CDD:214473 57/225 (25%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 61/243 (25%)
Tryp_SPc 46..280 CDD:238113 61/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.