DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG11037

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:232 Identity:58/232 - (25%)
Similarity:111/232 - (47%) Gaps:15/232 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIMGGE-DADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGSTN 88
            |::||. ..:|....:..:|..::..||||::|::..:||.|||..  |:: .||......|.:|
  Fly    61 RVIGGHVTTNAKLGGYLTALLYEDDFVCGGTLLNENIVLTAAHCFL--GRM-KASEWIVAAGISN 122

  Fly    89 QYAGGKIVNVESVAVHPDYY--NLNNNLAVITLSSELTYTDRITAIPLVASGEALPAEGSEVIVA 151
            ....|...:|:...:...:.  ::|.::||:.|.:.|. ...|..:.| .|....|  |.|::|:
  Fly   123 LNQKGIRRHVKDFILSEQFREDDMNMDVAVVLLKTPLK-AKNIGTLSL-CSVSLKP--GVELVVS 183

  Fly   152 GWGRTSD-GTNSYK-IRQISLKVAPEATCLDAY---SDHDEQSFCLAHELKEGTCHGDGGGGAIY 211
            |||.|:. |...:. :|.:::.:..:..|..||   :...:...|.|...::..|..|.||..::
  Fly   184 GWGMTAPRGRGPHNLLRTVTVPIIHKKNCRAAYQPTAKITDSMICAAVLGRKDACTFDSGGPLVF 248

  Fly   212 GNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQEQI 248
            ...:.|:.:|.:|...:|||.|:..:.....:|::.|
  Fly   249 KKQVCGIVSFGIGCASNRYPGVYTDVMYVKPFIEKSI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 53/211 (25%)
Tryp_SPc 42..244 CDD:214473 52/208 (25%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 56/226 (25%)
Tryp_SPc 62..283 CDD:238113 56/227 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.