DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Sems

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:232 Identity:59/232 - (25%)
Similarity:103/232 - (44%) Gaps:39/232 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QGRIMGGE-DADATATTFTASLRVDNAHVCGGSILSQTKILTTAHC----VHRDGKLIDA--SRL 80
            |.|::||. ..:|....:..::|..|..:|||:::.:..:||.|||    ..::...:|.  |||
  Fly    41 QTRVIGGRVTTNAKLGGYLVAMRYFNNFICGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGISRL 105

  Fly    81 ACRVGSTNQY------AGGKIV--NVESVAVHPDYYNLNNNLAVITLSSELTYTDRITAIPLVAS 137
            : ..|...|.      |..|:|  |::...|..:...:..|:..::|.|        ||:     
  Fly   106 S-EKGIRRQVKRFIKSAQFKMVTMNMDVAVVLLNRPMVGKNIGTLSLCS--------TAL----- 156

  Fly   138 GEALPAEGSEVIVAGWGRTS--DGTNSYKIRQISLKVAPEATCLDAYSDH---DEQSFCLAHELK 197
                 ..|..:.|:|||.|:  |....:.:|.:|:.|..:..|.:||.:.   .:..||.:...|
  Fly   157 -----TPGQTMDVSGWGMTNPDDEGPGHMLRTVSVPVIEKRICREAYRESVSISDSMFCASVLGK 216

  Fly   198 EGTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVF 234
            :..|..|.||..:|...:.|:.:|.:|....|||.|:
  Fly   217 KDACTYDSGGPLVYEKQVCGIVSFGIGCASRRYPGVY 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 54/212 (25%)
Tryp_SPc 42..244 CDD:214473 54/212 (25%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 58/230 (25%)
Tryp_SPc 44..265 CDD:238113 57/229 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.